General Information

  • ID:  hor004007
  • Uniprot ID:  A0A8J5J8V2??170-174)
  • Protein name:  Pyrokinin
  • Gene name:  NA
  • Organism:  Homarus americanus (American lobster)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  FSPRL
  • Length:  5(170-174)
  • Propeptide:  MESQYKSLLVSDRTTAEEVVELLLNCCNTPDNKCYYAIHEVESYCPPGVTVLLGDIVLLGDIVVLGHCSPGHCSPGVIVLLGSLFSWVIVLLGHCSPGVRRSPDYNDRMILPQERPLEVKAQWPRDRQAEFVFVLRRNMSQALSLRRLSLRTGDTKRPTVAGSQGEQTHFSPRLQWSQWLGTSWLPPPPSQKTAKTQDRINVLIIEEAVIDCTDVTPKMTTINRTATQGCKGALEVFNGTTSTSAINSQLHHNTS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004007_AF2.pdbhor004007_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 69025 Formula: C29H46N8O7
Absent amino acids: ACDEGHIKMNQTVWY Common amino acids: FLPRS
pI: 10.55 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 2
Hydrophobicity: -6 Boman Index: -1042
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 78
Instability Index: 8080 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18304551
  • Title:  Mass Spectral Characterization of Peptide Transmitters/Hormones in the Nervous System and Neuroendocrine Organs of the American Lobster Homarus Americanus